PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G124300.1
Common NamePHAVU_010G124300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 184aa    MW: 21001.1 Da    PI: 9.5914
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G124300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.75.5e-172669447
                        -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
              SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                        e   +r vtfskR+ g++ K  ELS LC ae a+ii s++gk+y
  Phvul.010G124300.1 26 EQRKRRCVTFSKRKLGLFNKLTELSLLCKAELALIITSQNGKVY 69
                        67789**************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-171574IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.5631575IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-201691IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-151737IPR002100Transcription factor, MADS-box
PfamPF003192.0E-162670IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-153752IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-155273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MAPSSKANNG TTPNSRKGKI EMKEDEQRKR RCVTFSKRKL GLFNKLTELS LLCKAELALI  60
ITSQNGKVYS CGYPNTDAVL HRYITGGPSQ HCSGTSEKEK EKEKFLEKQR LEYESVQDKL  120
KEKQKQLKEM KGAEKNSSCF PPWWNLSTED MGLEDLEQFK TSLENLKVNL ITTLQEKKLQ  180
NLH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135376.11e-133hypothetical protein PHAVU_010G124300g
TrEMBLV7APX21e-133V7APX2_PHAVU; Uncharacterized protein
STRINGGLYMA07G05001.11e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132271027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-20AGAMOUS-like 62